Recombinant Heterosigma akashiwo ATP synthase subunit b, chloroplastic (atpF)
This Recombinant Heterosigma akashiwo ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-182.
Product Specifications
Product Name Alternative
ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I
UniProt
B2XTP4
Expression Region
1-182
Origin
Heterosigma akashiwo (strain CCMP452)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MENLTNIFLFLSNENEGIQLNTDIFEANIINLALLIVLVINVAKDVLGSILSARKASILD KIEEADKKLNEADKRFTEARLQWSQANIFGEDLEKKTYQRINAFHESQNLKNKDALLREY FSTLVVLDLKNEQVQKQVRNYVMELALIEVYGVFTKLVANKKFQENYSNYSVLLLEKLIG EK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470276-100 1x 100 µL
TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041037-100 1x 100 µL
CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 