Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPL044C (YPL044C)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPL044C (YPL044C) spans the amino acid sequence from region 1-182.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YPL044C

UniProt

O13520

Expression Region

1-182

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVASTTVPYLPKIFFNLTGSRQLHGIFLIINFGLPFSMESSPSASSSSSLFWPVIFSDDS GVLFSTTSDVFFERSLLLAMSTLKICPLNLVFLALARASFVSSSTAKLTNPKPLDLLFVS LTTTACLIGAKLEKKSASCSSVTSWGIDLTNKVFISRPSSFCFETLLEGTSTFSIVSSIS LW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Aggrecan (AGC) ELISA Kit
RDR-AGC-Ra-01 96 Tests

Rat Aggrecan (AGC) ELISA Kit

Sign In for Pricing
View Details
Rat Aggrecan (AGC) ELISA Kit
RDR-AGC-Ra-02 48 Tests

Rat Aggrecan (AGC) ELISA Kit

Sign In for Pricing
View Details
Potassium Dichromate
TRC-P695110-50G 50 g

Potassium Dichromate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Horseradish Peroxidase,  5nm
GM-503-5 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Horseradish Peroxidase, 5nm

Sign In for Pricing
View Details
Recombinant Mouse c-MET/HGFR Protein (Fc Tag) (Fc Tag)
PKSM040581-01 100 µg

Recombinant Mouse c-MET/HGFR Protein (Fc Tag) (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse c-MET/HGFR Protein (Fc Tag) (Fc Tag)
PKSM040581-02 1 mg

Recombinant Mouse c-MET/HGFR Protein (Fc Tag) (Fc Tag)

Sign In for Pricing
View Details