Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPL044C (YPL044C)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPL044C (YPL044C) spans the amino acid sequence from region 1-182.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YPL044C

UniProt

O13520

Expression Region

1-182

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVASTTVPYLPKIFFNLTGSRQLHGIFLIINFGLPFSMESSPSASSSSSLFWPVIFSDDS GVLFSTTSDVFFERSLLLAMSTLKICPLNLVFLALARASFVSSSTAKLTNPKPLDLLFVS LTTTACLIGAKLEKKSASCSSVTSWGIDLTNKVFISRPSSFCFETLLEGTSTFSIVSSIS LW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cephradine Sulfoxide
TRC-C261850-10MG 10 mg

Cephradine Sulfoxide

Sign In for Pricing
View Details
Lipin 1 (LPIN1) Mouse Monoclonal Antibody [Clone ID: OTI1B2]
CF806208 100 µg

Lipin 1 (LPIN1) Mouse Monoclonal Antibody [Clone ID: OTI1B2]

Sign In for Pricing
View Details
ZAP70 (NM_001079) Human Over-expression Lysate
LC421504 20 µg

ZAP70 (NM_001079) Human Over-expression Lysate

Sign In for Pricing
View Details
MMP13 Rabbit Polyclonal Antibody
AP06226PU-N 100 µg

MMP13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Trimazosin Hydrochloride
TRC-T795515-25MG 25 mg

Trimazosin Hydrochloride

Sign In for Pricing
View Details
Octafluoroadipic Acid
TRC-O148533-1G 1 g

Octafluoroadipic Acid

Sign In for Pricing
View Details