Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0696 (MJ0696)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0696 (MJ0696) spans the amino acid sequence from region 1-182.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0696

UniProt

Q58107

Expression Region

1-182

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESILFIAIAFLINSFISYKITNMQPKIKSRIFKRVKMHYLNLIEGKKAEFDKKAMPILF GFMIIALISFNILLYVVYNCPVSITSIIAEILIIISMIIIWKAFNKEISVYLCDDGIYYS NKFISWKNIENVKKDDGFIVLFGKKKKILGRKLYLLQRIYLKYDEEIENIIKNQIEKFRD KA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin-17D
MBS2889657 Inquire

Interleukin-17D

Sign In for Pricing
View Details
ELISA Kit For G protein-coupled receptor kinase 4
E9564h 96 Tests

ELISA Kit For G protein-coupled receptor kinase 4

Sign In for Pricing
View Details
AroA Antibody
orb863516 2 mg

AroA Antibody

Sign In for Pricing
View Details
ATP7A Rabbit Polyclonal Antibody (Cy5.5)
orb1054811 100 µL

ATP7A Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Ctla2b Protein Vector (Mouse) (pPB-N-His)
PV168715 500 ng

Ctla2b Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human Solute carrier family 12 member 3 (SLC12A3) ELISA Kit
SL3134Hu-01 96 Tests

Human Solute carrier family 12 member 3 (SLC12A3) ELISA Kit

Sign In for Pricing
View Details