Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ranunculus macranthus ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Ranunculus macranthus ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-183.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

A1XGM4

Expression Region

1-183

Origin

Ranunculus macranthus (Large buttercup)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKVTDSFVSLGHWPSAGSFGFNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LSTIRNSEELRGGAIEKLEKAKARLRKVKAEADEFRTNGYSEIEREKCNLINSTYQNLER LENYKNETIQFEQQRAINQVRQRIFQQALQGALGTLNSCLNNELHLRTISANIGMFGAMK EIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX2.8 (NKX28/3233R), CF488A conjugate, 0.1mg/mL
BNC883233-100 1x 100 µL

NKX2.8 (NKX28/3233R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant PGP9.5 Antibody
RC-4685-01 50 μL

Recombinant PGP9.5 Antibody

Sign In for Pricing
View Details
Recombinant PGP9.5 Antibody
RC-4685-02 100 µL

Recombinant PGP9.5 Antibody

Sign In for Pricing
View Details
Recombinant PGP9.5 Antibody
RC-4685-03 1 mL

Recombinant PGP9.5 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Testis
CS809288 5x 5 µm

Tissue FFPE Sections, Testis

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing's Sarcoma Marker), 1mg/mL
BNUM1655-50 1x 50 µL

NKX2.2 (Neuroendocrine & Ewing's Sarcoma Marker), 1mg/mL

Sign In for Pricing
View Details