Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brachypodium distachyon ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Brachypodium distachyon ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-183.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

B3TN47

Expression Region

1-183

Origin

Brachypodium distachyon (Purple false brome) (Trachynia distachya)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNVTHSFVFLAHWPSAGSFGLNTDILATNLINLTVVVGVLIFFGKGVLKDLLDNRKQRI LSTIRNSEELRRGTFEQLEKARIRLQKVELEADEYRMNGYSEIEREKENLINATSISLEQ LEKSKNETLYFEKQRAMNQVRQRVFQQAVQGALGTLNSCLNTELHFRTIRANIGILGSME WKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atp5b Mouse Gene Knockout Kit (CRISPR)
KN501788 1 Kit

Atp5b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MARK3 (NM_002376) Human Recombinant Protein
TP305758 20 µg

MARK3 (NM_002376) Human Recombinant Protein

Sign In for Pricing
View Details
CD68 (C68/684), CF647 conjugate, 0.1mg/mL
BNC470684-500 1x 500 µL

CD68 (C68/684), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMEM163 (NM_030923) Human Recombinant Protein
TP305533 20 µg

TMEM163 (NM_030923) Human Recombinant Protein

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF640R conjugate, 0.1mg/mL
BNC402044-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), CF568 conjugate, 0.1mg/mL
BNC682419-500 1x 500 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details