Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brachypodium distachyon ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Brachypodium distachyon ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-183.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

B3TN47

Expression Region

1-183

Origin

Brachypodium distachyon (Purple false brome) (Trachynia distachya)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNVTHSFVFLAHWPSAGSFGLNTDILATNLINLTVVVGVLIFFGKGVLKDLLDNRKQRI LSTIRNSEELRRGTFEQLEKARIRLQKVELEADEYRMNGYSEIEREKENLINATSISLEQ LEKSKNETLYFEKQRAMNQVRQRVFQQAVQGALGTLNSCLNTELHFRTIRANIGILGSME WKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM16A Recombinant Rabbit Monoclonal Antibody [PSH06-57]
HA722719 100 µL

TMEM16A Recombinant Rabbit Monoclonal Antibody [PSH06-57]

Sign In for Pricing
View Details
GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF647 conjugate, 0.1mg/mL
BNC473168-100 1x 100 µL

GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant L1CAM Antibody
RC-15559-01 50 μL

Recombinant L1CAM Antibody

Sign In for Pricing
View Details
Recombinant L1CAM Antibody
RC-15559-02 100 µL

Recombinant L1CAM Antibody

Sign In for Pricing
View Details
Recombinant L1CAM Antibody
RC-15559-03 1 mL

Recombinant L1CAM Antibody

Sign In for Pricing
View Details
ENSA Human Gene Knockout Kit (CRISPR)
KN401350 1 Kit

ENSA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details