Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 235 (Tmem235)

This Recombinant Mouse Transmembrane protein 235 (Tmem235) spans the amino acid sequence from region 29-211.

Product Specifications

Product Name Alternative

Transmembrane protein 235, Claudin-27

UniProt

B1AQL3

Expression Region

29-211

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DYWYILEVADAGGLGGVQLFSHSGLWRTCEGQNSCVPLIDPFASAGLEVSPSVQHLLSLH RTVMVVLPLSLVLIVCGWVCGLLSSLSQSVPLLLATGCYFLLGGALTLAGLSIYISYSHL AFVEAARTYGVTHVQNVHISFGWSLALAWASCASEVLSGALLLAAARLLSLSQRPGVPHS VIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS629367 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
HSP90AA1 Rabbit Polyclonal Antibody
TA371908 100 µL

HSP90AA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1,3-Bis(4-isobutoxybenzyl)urea
TRC-B448763-5MG 5 mg

1,3-Bis(4-isobutoxybenzyl)urea

Sign In for Pricing
View Details
S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF647 conjugate, 0.1mg/mL
BNC472224-500 1x 500 µL

S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Snf1lk2 (SIK2) Human Gene Knockout Kit (CRISPR)
KN421327 1 Kit

Snf1lk2 (SIK2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse MUC16 protein (His tag)
PDEM100315-01 20 µg

Recombinant Mouse MUC16 protein (His tag)

Sign In for Pricing
View Details