Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 235 (Tmem235)

This Recombinant Mouse Transmembrane protein 235 (Tmem235) spans the amino acid sequence from region 29-211.

Product Specifications

Product Name Alternative

Transmembrane protein 235, Claudin-27

UniProt

B1AQL3

Expression Region

29-211

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DYWYILEVADAGGLGGVQLFSHSGLWRTCEGQNSCVPLIDPFASAGLEVSPSVQHLLSLH RTVMVVLPLSLVLIVCGWVCGLLSSLSQSVPLLLATGCYFLLGGALTLAGLSIYISYSHL AFVEAARTYGVTHVQNVHISFGWSLALAWASCASEVLSGALLLAAARLLSLSQRPGVPHS VIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PTCHD3 activation kit by CRISPRa
GA117758 1 Kit

Human PTCHD3 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human ERP72/PDIA4 Protein (Fc Tag)
PKSH030655 100 µg

Recombinant Human ERP72/PDIA4 Protein (Fc Tag)

Sign In for Pricing
View Details
MUC5AC (Mucin 5AC / Gastric Mucin) (rMUC5AC/3779), CF488A conjugate, 0.1mg/mL
BNC883779-100 1x 100 µL

MUC5AC (Mucin 5AC / Gastric Mucin) (rMUC5AC/3779), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human RNF220 activation kit by CRISPRa
GA110583 1 Kit

Human RNF220 activation kit by CRISPRa

Sign In for Pricing
View Details
VOPP1 Human Gene Knockout Kit (CRISPR)
KN421464 1 Kit

VOPP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ZNF574 activation kit by CRISPRa
GA112128 1 Kit

Human ZNF574 activation kit by CRISPRa

Sign In for Pricing
View Details