Recombinant Maricaulis maris ATP synthase subunit b 2 (atpF2)
This Recombinant Maricaulis maris ATP synthase subunit b 2 (atpF2) spans the amino acid sequence from region 1-183.
Product Specifications
Product Name Alternative
ATP synthase subunit b 2, ATP synthase F (0) sector subunit b 2, ATPase subunit I 2, F-type ATPase subunit b 2, F-ATPase subunit b 2
UniProt
Q0AK30
Expression Region
1-183
Origin
Maricaulis maris (strain MCS10)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MMIRAEDAGHGEEQTLLEWLAAQPGDPSFYAFLALLIFFGLLLHMGVHRTIAKTLDDRAE GISNELDEAKRLREDAAEMLASYQRKQREAEAEAEAIIAQAKTEAKSLKAEARKEMTERL ERRTAMAEQRIAQAEAQAAADVKAAAAELAAQAAEEILKTQLKKSDLNKLVDADIKTVGQ RLN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471395-100 1x 100 µL
CD31 / PECAM-1 (Endothelial Cell Marker) (C31/1395R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882160-100 1x 100 µL
CD86 (Dendritic Cells Maturation Marker) (C86/2160R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 