Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b, chloroplastic (atpF)

This Recombinant ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-183.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q1XDP3

Expression Region

1-183

Origin

Porphyra yezoensis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNIVKIPQIITILSEHSSEHKFGFNSDIFEANVINILLLLFGLIYVLKQFLGSSLNARQ IKVLAAIQESEERLEQASARLSESEKQLAQTQIIIDQIKKEAQLTAGKVRSSILAQGQLD IERLAITGKSNIETAEKQIRRQIQQQITFLALKRVTLQLENQMSSEMQLRIIDNNIAKLG DQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC Class I Antibody
KC-31774-01 50 μL

MHC Class I Antibody

Sign In for Pricing
View Details
MHC Class I Antibody
KC-31774-02 100 µL

MHC Class I Antibody

Sign In for Pricing
View Details
MHC Class I Antibody
KC-31774-03 1 mL

MHC Class I Antibody

Sign In for Pricing
View Details
Zfp606 Mouse Gene Knockout Kit (CRISPR)
KN519901 1 Kit

Zfp606 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/2770), CF647 conjugate, 0.1mg/mL
BNC472770-500 1x 500 µL

TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/2770), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707827 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details