Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b, chloroplastic (atpF)

This Recombinant ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-183.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q1XDP3

Expression Region

1-183

Origin

Porphyra yezoensis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNIVKIPQIITILSEHSSEHKFGFNSDIFEANVINILLLLFGLIYVLKQFLGSSLNARQ IKVLAAIQESEERLEQASARLSESEKQLAQTQIIIDQIKKEAQLTAGKVRSSILAQGQLD IERLAITGKSNIETAEKQIRRQIQQQITFLALKRVTLQLENQMSSEMQLRIIDNNIAKLG DQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xpr1 Mouse Gene Knockout Kit (CRISPR)
KN519519 1 Kit

Xpr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PRAS40 (AKT1S1) (NM_001098632) Human Over-expression Lysate
LY420655 100 µg

PRAS40 (AKT1S1) (NM_001098632) Human Over-expression Lysate

Sign In for Pricing
View Details
(S)-3,5-Dihydroxylphenylglycine
TRC-D454520-5MG 5 mg

(S)-3,5-Dihydroxylphenylglycine

Sign In for Pricing
View Details
1-(4-Bromo-1-phenylbutyl)-4-fluorobenzene
TRC-B687580-250MG 250 mg

1-(4-Bromo-1-phenylbutyl)-4-fluorobenzene

Sign In for Pricing
View Details
ASS1P3 Human qPCR Primer Pair (XM_095989)
HP221074 200 Reactions

ASS1P3 Human qPCR Primer Pair (XM_095989)

Sign In for Pricing
View Details
CD73 (Immuno-Oncology Target) (NT5E/2505), CF640R conjugate, 0.1mg/mL
BNC402505-500 1x 500 µL

CD73 (Immuno-Oncology Target) (NT5E/2505), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details