Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bcl10-interacting CARD protein

This Recombinant Mouse Bcl10-interacting CARD protein spans the amino acid sequence from region 1-183.

Product Specifications

Product Name Alternative

Bcl10-interacting CARD protein, BinCARD

UniProt

Q9D1I2

Expression Region

1-183

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDQTYCDRLVQDTPFLTGQGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRV RLCDLLSHLQQRGERHCQEFYRALYIHAQPLHSHLPSRYSPQNSDCRELDWGIESRELSD RGPMSFLAGLGLAAGLALLLYCCPPDPKVLPGTRRVLAFSPVIIDRHVSRYLLAFLADDL GGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP1B2 (NM_001678) Human Tagged Lenti ORF Clone
RC220004L2 10 µg

ATP1B2 (NM_001678) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ccdc48 siRNA Oligos set (Mouse)
15271174 3x 5 nmol

Ccdc48 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Baloxavir marboxil
HY-109025-01 25 mg

Baloxavir marboxil

Sign In for Pricing
View Details
Baloxavir marboxil
HY-109025-02 10 mM - 1 mL

Baloxavir marboxil

Sign In for Pricing
View Details
Baloxavir marboxil
HY-109025-03 50 mg

Baloxavir marboxil

Sign In for Pricing
View Details
Baloxavir marboxil
HY-109025-04 100 mg

Baloxavir marboxil

Sign In for Pricing
View Details