Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bcl10-interacting CARD protein

This Recombinant Mouse Bcl10-interacting CARD protein spans the amino acid sequence from region 1-183.

Product Specifications

Product Name Alternative

Bcl10-interacting CARD protein, BinCARD

UniProt

Q9D1I2

Expression Region

1-183

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDQTYCDRLVQDTPFLTGQGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRV RLCDLLSHLQQRGERHCQEFYRALYIHAQPLHSHLPSRYSPQNSDCRELDWGIESRELSD RGPMSFLAGLGLAAGLALLLYCCPPDPKVLPGTRRVLAFSPVIIDRHVSRYLLAFLADDL GGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPM1 3'UTR Lenti-reporter-Luc Vector
48520081 1.0 µg

TRPM1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Lentiviral human MAP4K1 sgRNA gene knockout kit - Lentiviral human MAP4K1 sgRNA gene knockout kit (100)
GTR15354780 1 Vial

Lentiviral human MAP4K1 sgRNA gene knockout kit - Lentiviral human MAP4K1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
CLK1 Double Nickase Plasmid (h)
sc-402793-NIC 20 µg

CLK1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
OR2L9P Protein Vector (Human) (pPB-C-His)
PV106622 500 ng

OR2L9P Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Strictinin
TBZ0902 unit

Strictinin

Sign In for Pricing
View Details
KLHDC4 (Kelch Domain-containing Protein 4, DKFZp434G0522, FLJ00104) APC
MBS6137316-01 0.1 mL

KLHDC4 (Kelch Domain-containing Protein 4, DKFZp434G0522, FLJ00104) APC

Sign In for Pricing
View Details