Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 6 (CMTM6)
This Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 6 (CMTM6) spans the amino acid sequence from region 1-183.
Product Specifications
Product Name Alternative
CKLF-like MARVEL transmembrane domain-containing protein 6, Chemokine-like factor superfamily member 6
UniProt
Q9NX76
Expression Region
1-183
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVVS QCTLCGGLYFFEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLA SIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEP LNA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400008-500 1x 500 µL
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680296-500 1x 500 µL
Blood Group Antigen B (CD173) (HEB-20), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471098-500 1x 500 µL
Cyclin B1 (CCNB1/1098), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details