Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane and coiled-coil domain-containing protein 2 (Tmco2)

This Recombinant Mouse Transmembrane and coiled-coil domain-containing protein 2 (Tmco2) spans the amino acid sequence from region 1-183.

Product Specifications

Product Name Alternative

Transmembrane and coiled-coil domain-containing protein 2

UniProt

P0C1V4

Expression Region

1-183

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTFPTTTSSWDNLLNALARSSIWNWLQAMFIGETTSAPQPTNLGILDNLAPAVQIILGI SFLTLLAIGLFALWKRSIRSIQKIVMFVITLYQLYKKGSDFFQVLLANPEGSGRQIQDNN NIFLSLGLQEKILKKLQMVENKVRDLEGIIVARKPASKRDCSSEPYCSCSDCQSPLPTSG FTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbm28 3'UTR Lenti-reporter-Luc Vector
38625086 1.0 µg

Rbm28 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Papilloma Virus, Human, Type 1 (hPV) (HRP)
MBS6243904-01 0.1 mL

Papilloma Virus, Human, Type 1 (hPV) (HRP)

Sign In for Pricing
View Details
Papilloma Virus, Human, Type 1 (hPV) (HRP)
MBS6243904-02 5x 0.1 mL

Papilloma Virus, Human, Type 1 (hPV) (HRP)

Sign In for Pricing
View Details
PKP3 AAV Vector (Rat) (CMV)
36893106 1 µg

PKP3 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Recombinant SOX2 Antibody
V7864SAF-100UG 100 µg

Recombinant SOX2 Antibody

Sign In for Pricing
View Details
NDUFA13, NT (NDUFA13, GRIM19, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13, Cell death regulatory protein GRIM-19, Complex I-B16.6, Gene associated with retinoic and interferon-induced mortality 19 protein, NADH-ubiquinone oxidoreductase B16.6 subunit) (MaxLight 405) discontinued
038858-ML405 100 µL

NDUFA13, NT (NDUFA13, GRIM19, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13, Cell death regulatory protein GRIM-19, Complex I-B16.6, Gene associated with retinoic and interferon-induced mortality 19 protein, NADH-ubiquinone oxidoreductase B16.6 subunit) (MaxLight 405) discontinued

Sign In for Pricing
View Details