Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane and coiled-coil domain-containing protein 2 (Tmco2)

This Recombinant Mouse Transmembrane and coiled-coil domain-containing protein 2 (Tmco2) spans the amino acid sequence from region 1-183.

Product Specifications

Product Name Alternative

Transmembrane and coiled-coil domain-containing protein 2

UniProt

P0C1V4

Expression Region

1-183

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTFPTTTSSWDNLLNALARSSIWNWLQAMFIGETTSAPQPTNLGILDNLAPAVQIILGI SFLTLLAIGLFALWKRSIRSIQKIVMFVITLYQLYKKGSDFFQVLLANPEGSGRQIQDNN NIFLSLGLQEKILKKLQMVENKVRDLEGIIVARKPASKRDCSSEPYCSCSDCQSPLPTSG FTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

galectin-12 Lentiviral Activation Particles (h2)
sc-405131-LAC-2 200 µL

galectin-12 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Mterfd3 3'UTR GFP Stable Cell Line
TU263516 1.0 mL

Mterfd3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Vmn1r128 Protein Lysate (Mouse) with C-HA Tag
49546034 100 µg

Vmn1r128 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
TTC38 CRISPRa sgRNA lentivector (set of three targets)(Human)
48694121 3x 1.0µg DNA

TTC38 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Peroxin 16 shRNA (m) Lentiviral Particles
sc-152173-V 200 µL

Peroxin 16 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Anti-ST2/IL-1 RL1 Antibody, Rabbit Polyclonal
MBS8112355-01 0.1 mL

Anti-ST2/IL-1 RL1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details