Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brassica napus Oleosin Bn-V

This Recombinant Brassica napus Oleosin Bn-V spans the amino acid sequence from region 1-183.

Product Specifications

Product Name Alternative

Oleosin Bn-V, BnV

UniProt

P29109

Expression Region

1-183

Origin

Brassica napus (Rape)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PARTHHDITTRDQYPLISRDRDQYGMIGRDQYNMSGQNYSKSRQIAKATTAVTAGDSLLV LSSLTLVGTVIALIVATPLLVIFSPILVPALITVALLITGFLSSGAFGIAAITVFSWIYK YATGEHPQGSDKLDSARMKLGSKAQDMKDRAYYYGQQHTGEEHDRDRDHRTDRDRTRGTQ HTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL
BNC880437-100 1x 100 µL

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
BNC700745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-100 1x 100 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin Receptor (PRLR/742), CF740 conjugate, 0.1mg/mL
BNC740742-100 1x 100 µL

Prolactin Receptor (PRLR/742), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (TFRC/1059), CF568 conjugate, 0.1mg/mL
BNC681059-100 1x 100 µL

CD71 (TFRC/1059), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF594 conjugate, 0.1mg/mL
BNC941803-100 1x 100 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details