Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pinus koraiensis Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Pinus koraiensis Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

P62721

Expression Region

1-184

Origin

Pinus koraiensis (Korean pine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRRSKWLWIEPITGSRKRSNFFWACILFLGSLGFFLVGISSYFGENLIPLLSSQQILFV PQGIVMCFYGIAGLFISSYLWCTILFNVGSGYNKFDKKKGIVCLFRWGFPGINRRIFSRF LMKDIQMIKTEIQEGISPRRVLYMEIKGRQDIPLTRTGDNVNLREIEQKAAESARFLRVS IEGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF680R conjugate, 0.1mg/mL
BNC810322-100 1x 100 µL

CD3e (RIV9), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-100 1x 100 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/837), CF568 conjugate, 0.1mg/mL
BNC680837-500 1x 500 µL

Ep-CAM / CD326 (EGP40/837), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 13 (Non-Keratinized Squamous Epithelial Marker) (KRT13/2213), CF647 conjugate, 0.1mg/mL
BNC472659-100 1x 100 µL

Cytokeratin 13 (Non-Keratinized Squamous Epithelial Marker) (KRT13/2213), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGFalpha (P/T1), CF488A conjugate, 0.1mg/mL
BNC880787-100 1x 100 µL

TGFalpha (P/T1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details