Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ygiM (ygiM)

This Recombinant Uncharacterized protein ygiM (ygiM) spans the amino acid sequence from region 23-206.

Product Specifications

Product Name Alternative

Uncharacterized protein ygiM

UniProt

P0ADU0

Expression Region

23-206

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EETRYVSDELNTWVRSGPGDHYRLVGTVNAGEEVTLLQTDANTNYAQVKDSSGRTAWIPL KQLSTEPSLRSRVPDLENQVKTLTDKLTNIDNTWNQRTAEMQQKVAQSDSVINGLKEENQ KLKNELIVAQKKVDAASVQLDDKQRTIIMQWFMYGGGVLGLGLLLGLVLPHLIPSRKRKD RWMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal BFAR Antibody
NBP2-86584-0.1mL 0.1 mL

Rabbit Polyclonal BFAR Antibody

Sign In for Pricing
View Details
UHRF1 Antibody
orb688717 100 µL

UHRF1 Antibody

Sign In for Pricing
View Details
ZNF642 AAV Vector (Human) (CMV)
51690101 1 µg

ZNF642 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
NR1D2 Peptide
MBS3229119-01 0.1 mg

NR1D2 Peptide

Sign In for Pricing
View Details
NR1D2 Peptide
MBS3229119-02 5x 0.1 mg

NR1D2 Peptide

Sign In for Pricing
View Details
Human p15 INK4b (CDKN2B) (NM_004936) AAV Particle
RC204895A1V 250 µL

Human p15 INK4b (CDKN2B) (NM_004936) AAV Particle

Sign In for Pricing
View Details