Recombinant Enterobacteria phage lambda Superinfection exclusion protein B (sieB)
This Recombinant Enterobacteria phage lambda Superinfection exclusion protein B (sieB) spans the amino acid sequence from region 1-184.
Product Specifications
Product Name Alternative
Superinfection exclusion protein B
UniProt
P03762
Expression Region
1-184
Origin
Enterobacteria phage lambda (Bacteriophage lambda)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MMSIEMDPLVILGRVFSNEPLERTMYMIVIWVGLLLLSPDNWPEYVNERIGIPHVWHVFV FALAFSLAINVHRLSAIASARYKRFKLRKRIKMQNDKVRSVIQNLTEEQSMVLCAALNEG RKYVVTSKQFPYISELIELGVLNKTFSRWNGKHILFPIEDIYWTELVASYDPYNIEIKPR PISK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A08860-1-Fluoro488 100 µg/Vial
Anti-Pannexin 2/PANX2 Picoband® Antibody Fluoro488 Conjugated
Sign In for Pricing
View Details 
MBS6243695-01 0.1 mL
CUG-Binding Protein 1 Ribonucleoprotein (CUG-BPI, Cytidine Uridine Guanosine Binding Protein 1) (HRP)
Sign In for Pricing
View Details MBS6243695-02 5x 0.1 mL
CUG-Binding Protein 1 Ribonucleoprotein (CUG-BPI, Cytidine Uridine Guanosine Binding Protein 1) (HRP)
Sign In for Pricing
View Details