Recombinant Olimarabidopsis pumila ATP synthase subunit b, chloroplastic (atpF)
This Recombinant Olimarabidopsis pumila ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.
Product Specifications
Product Name Alternative
ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I
UniProt
A4QJR9
Expression Region
1-184
Origin
Olimarabidopsis pumila (Dwarf rocket) (Arabidopsis griffithiana)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKTLTDSFVYLGHWPSAGSFGFNTDILATNPINLSVVFGVLIFFGKGVLNDLLDNRKQRI LNTIRNSEELREGAIQQLENALARLRKVETEADQFRVNGYSEIEREKLNLINSTYKTLKQ LENYKNETILFEQQRTINQVRERVFQQALQGAIGTLNSCLSNELHLRTINANIGMFGTMK EITD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042024-100 1x 100 µL
Tyrosinase (Melanoma Marker) (TYR/2024R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940795-500 1x 500 µL
CD56 / NCAM (NCAM1/795), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472298-500 1x 500 µL
Cytokeratin 8/18 (rKRT8.18/1346), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details