Recombinant Arabis hirsuta ATP synthase subunit b, chloroplastic (atpF)
This Recombinant Arabis hirsuta ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.
Product Specifications
Product Name Alternative
ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I
UniProt
A4QK04
Expression Region
1-184
Origin
Arabis hirsuta (Hairy rock-cress) (Turritis hirsuta)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKNLTDSFVYLGHWPSAGSFGFNTDILATNPINLSVVFGVLIFFGKGVLNDLLDNRKQRI LNTIRNSEELREGAIQQLENARIRLRKVETEADQFRVNGYSEIEREKLNLINSTYRTLKQ LENYKNETILFEQQRTINQVRERVFQQALQGAIGTLNSCLSNELHLRTINANIGMFGTMK EITD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881045-100 1x 100 µL
CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470824-100 1x 100 µL
CD68 (LAMP4/824), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details