Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lepidium virginicum ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Lepidium virginicum ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

A4QL92

Expression Region

1-184

Origin

Lepidium virginicum (Virginia pepperweed)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNLTDSFVYLGHWPSAGSFGFNTDILATNPINLSVVLGVLIFFGKGVLNDLLDNRKQRI LNTIRNSDELREGAIQQLENARARLRKVETEADKFRVNGYSEIEREKLNLINSTDKTLKQ LENYKNETILFEQQKTINQVRERVFQQALQGAIGTLNSCLNNELHLRTINANIGMFGTMK ETTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Peroxiredoxin 5 (PRDX5) ELISA Kit
orb1663963-01 48 Tests

Human Peroxiredoxin 5 (PRDX5) ELISA Kit

Sign In for Pricing
View Details
Human Peroxiredoxin 5 (PRDX5) ELISA Kit
orb1663963-02 96 Tests

Human Peroxiredoxin 5 (PRDX5) ELISA Kit

Sign In for Pricing
View Details
Anti-Human CD19-FITC conjugate
CD19F-100 100 Tests

Anti-Human CD19-FITC conjugate

Sign In for Pricing
View Details
Monoamine Oxidase A (MAOA) Antibody
abx001199-01 60 µL

Monoamine Oxidase A (MAOA) Antibody

Sign In for Pricing
View Details
Monoamine Oxidase A (MAOA) Antibody
abx001199-02 120 µL

Monoamine Oxidase A (MAOA) Antibody

Sign In for Pricing
View Details
Monoamine Oxidase A (MAOA) Antibody
abx001199-03 200 µL

Monoamine Oxidase A (MAOA) Antibody

Sign In for Pricing
View Details