Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta reflexa Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Cuscuta reflexa Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

A7M975

Expression Region

1-184

Origin

Cuscuta reflexa (Southern Asian dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWRSEHIWIDLITGSRKISNLCWAFTLFLGSLGFVLVGTYSYLGRNLISFFPLQQIIFF PQGIVMSFYGIAGLFISSYLWCTISWNVGSGYDLFNRKEGIVCIFRWGFPGINRRIFLRF LLKDIRSVRIEVEEGIYAGRVLYMDIRGHRAIPLTRTDENLTPGELEKKAAELAYFLRVP IEVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-100 1x 100 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (COL-1), Biotin conjugate, 0.1mg/mL
BNCB0002-100 1x 100 µL

CD66 (CEA) (COL-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C8orf86 (NM_207412) Human Over-expression Lysate
LY404018 100 µg

C8orf86 (NM_207412) Human Over-expression Lysate

Sign In for Pricing
View Details
Orexin (HCRT) (NM_001524) Human Over-expression Lysate
LY419884 100 µg

Orexin (HCRT) (NM_001524) Human Over-expression Lysate

Sign In for Pricing
View Details
Z-AA-R110-PEG (Rhodamine 110-PEG, N-CBZ-L-alanyl-L-alanine amide)
#10220 1x 1 mg

Z-AA-R110-PEG (Rhodamine 110-PEG, N-CBZ-L-alanyl-L-alanine amide)

Sign In for Pricing
View Details
Human Beta-2-microglobulin/B2M, C-His Tag
HA210978-01 Inquire

Human Beta-2-microglobulin/B2M, C-His Tag

Sign In for Pricing
View Details