Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta reflexa Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Cuscuta reflexa Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

A7M975

Expression Region

1-184

Origin

Cuscuta reflexa (Southern Asian dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWRSEHIWIDLITGSRKISNLCWAFTLFLGSLGFVLVGTYSYLGRNLISFFPLQQIIFF PQGIVMSFYGIAGLFISSYLWCTISWNVGSGYDLFNRKEGIVCIFRWGFPGINRRIFLRF LLKDIRSVRIEVEEGIYAGRVLYMDIRGHRAIPLTRTDENLTPGELEKKAAELAYFLRVP IEVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL7B Polyclonal Antibody
E-AB-53079-01 20 µL

BCL7B Polyclonal Antibody

Sign In for Pricing
View Details
BCL7B Polyclonal Antibody
E-AB-53079-02 60 µL

BCL7B Polyclonal Antibody

Sign In for Pricing
View Details
BCL7B Polyclonal Antibody
E-AB-53079-03 120 µL

BCL7B Polyclonal Antibody

Sign In for Pricing
View Details
BCL7B Polyclonal Antibody
E-AB-53079-04 200 µL

BCL7B Polyclonal Antibody

Sign In for Pricing
View Details
GSK 1016790A
TRC-G797440-5MG 5 mg

GSK 1016790A

Sign In for Pricing
View Details
Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF640R conjugate, 0.1mg/mL
BNC402899-500 1x 500 µL

Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details