Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta reflexa ATP synthase subunit b, plastid (atpF)

This Recombinant Cuscuta reflexa ATP synthase subunit b, plastid (atpF) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

ATP synthase subunit b, plastid, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

A7M952

Expression Region

1-184

Origin

Cuscuta reflexa (Southern Asian dodder)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNVTDSFLSLGHWSSAGSFGLNTDILATNLINLSVVLGVLIFFGKGVLSDLLDNRKRRI LKTIQNSEELGVGAVEKLEKARARLRKVKTEAEQFLVNGYFDIEQEKLNLIKSTYNTLEQ LENDKNENLRFEQQRVIYQVRQRFFQKALQRAIGTLNGCLNNELHLRTISANIGMLGTIK EITD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRIA2 Antibody
KC-33760-01 50 μL

GRIA2 Antibody

Sign In for Pricing
View Details
GRIA2 Antibody
KC-33760-02 100 µL

GRIA2 Antibody

Sign In for Pricing
View Details
GRIA2 Antibody
KC-33760-03 1 mL

GRIA2 Antibody

Sign In for Pricing
View Details
Taf12 (NM_025579) Mouse Tagged ORF Clone
MG201255 10 µg

Taf12 (NM_025579) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human LRRC17 activation kit by CRISPRa
GA106962 1 Kit

Human LRRC17 activation kit by CRISPRa

Sign In for Pricing
View Details
Ephrin B1 (EFNB1) Human Gene Knockout Kit (CRISPR)
KN401886 1 Kit

Ephrin B1 (EFNB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details