Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ceratophyllum demersum ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Ceratophyllum demersum ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

A8SE63

Expression Region

1-184

Origin

Ceratophyllum demersum (Rigid hornwort) (Coontail)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNVTDSFVSLGDWPYAGSFAFNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKQKI LSSIRNSEELRAKAIEQLEKARARLRKVEIEADKFRVNGYSEIEREKGNLINSTYENLQR LENYKNEAIQFEQQRTINQVRQRVFQQALQEALETLNSCLNSELHLRTISANIVMLGVMK EITD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-100 1x 100 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-100 1x 100 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CGA414 + CGA/777 + CGA/798), CF640R conjugate, 0.1mg/mL
BNC401060-100 1x 100 µL

Chromogranin A (CGA414 + CGA/777 + CGA/798), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin D1 (CCND1/809), CF555 conjugate, 0.1mg/mL
BNC550809-500 1x 500 µL

Cyclin D1 (CCND1/809), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C3), CF647 conjugate, 0.1mg/mL
BNC470354-500 1x 500 µL

AFP (Alpha Fetoprotein) (C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TMS715), CF405S conjugate, 0.1mg/mL
BNC040715-500 1x 500 µL

Thymidylate Synthase (TMS715), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details