Recombinant Cuscuta exaltata ATP synthase subunit b, chloroplastic (atpF)
This Recombinant Cuscuta exaltata ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.
Product Specifications
Product Name Alternative
ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I
UniProt
A8W3B0
Expression Region
1-184
Origin
Cuscuta exaltata (Tall dodder)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKNVTDSFLSLGHWSSAGSFGLNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LKTIQNSEELGVGAVEKLEKARSRLRKVKTEAEQFLVNGYSDIEREKFNLIKSTSNTLEQ LENDKNETLRFEQQRLIYQVRQRFFQQALQRAIGTLNSCLNNELHLRTISANIGMLGTIK EITD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1156952 Inquire
Recombinant Lachancea thermotolerans Altered inheritance of mitochondria protein 9, mitochondrial (AIM9), partial
Sign In for Pricing
View Details 
SPEB00MCX01060A 100 Pieces/Case:100 Pieces/ PACKS:1 PACKS/CASE
MCX SPE Cartridges60mg/1ml
Sign In for Pricing
View Details 
GTR15207711 1 Vial
Lentiviral mouse 9930111J21Rik2 shRNA (UAS) - Lentiviral mouse 9930111J21Rik2 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details