Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta exaltata ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Cuscuta exaltata ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

A8W3B0

Expression Region

1-184

Origin

Cuscuta exaltata (Tall dodder)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNVTDSFLSLGHWSSAGSFGLNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LKTIQNSEELGVGAVEKLEKARSRLRKVKTEAEQFLVNGYSDIEREKFNLIKSTSNTLEQ LENDKNETLRFEQQRLIYQVRQRFFQQALQRAIGTLNSCLNNELHLRTISANIGMLGTIK EITD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Crucihimalaya wallichii NAD (P)H-quinone oxidoreductase subunit K, chloroplastic
MBS1049274-01 0.02 mg (E-Coli)

Recombinant Crucihimalaya wallichii NAD (P)H-quinone oxidoreductase subunit K, chloroplastic

Sign In for Pricing
View Details
Recombinant Crucihimalaya wallichii NAD (P)H-quinone oxidoreductase subunit K, chloroplastic
MBS1049274-02 0.1 mg (E-Coli)

Recombinant Crucihimalaya wallichii NAD (P)H-quinone oxidoreductase subunit K, chloroplastic

Sign In for Pricing
View Details
Recombinant Crucihimalaya wallichii NAD (P)H-quinone oxidoreductase subunit K, chloroplastic
MBS1049274-03 0.02 mg (Yeast)

Recombinant Crucihimalaya wallichii NAD (P)H-quinone oxidoreductase subunit K, chloroplastic

Sign In for Pricing
View Details
Recombinant Crucihimalaya wallichii NAD (P)H-quinone oxidoreductase subunit K, chloroplastic
MBS1049274-04 0.1 mg (Yeast)

Recombinant Crucihimalaya wallichii NAD (P)H-quinone oxidoreductase subunit K, chloroplastic

Sign In for Pricing
View Details
Recombinant Crucihimalaya wallichii NAD (P)H-quinone oxidoreductase subunit K, chloroplastic
MBS1049274-05 0.02 mg (Baculovirus)

Recombinant Crucihimalaya wallichii NAD (P)H-quinone oxidoreductase subunit K, chloroplastic

Sign In for Pricing
View Details
Recombinant Crucihimalaya wallichii NAD (P)H-quinone oxidoreductase subunit K, chloroplastic
MBS1049274-06 0.02 mg (Mammalian-Cell)

Recombinant Crucihimalaya wallichii NAD (P)H-quinone oxidoreductase subunit K, chloroplastic

Sign In for Pricing
View Details