Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta exaltata Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Cuscuta exaltata Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

A8W3D3

Expression Region

1-184

Origin

Cuscuta exaltata (Tall dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWRSEHIWIELIAGSRKISNLCWAFILFLGSLGFFLVGTSSYLGRNLISFFPLQQIIFF PQGIVMSFYGIAGLFISSYLWCTISWNVGSGYDLFNRKEGIVCIFRWGFPGINRRIFLRF LLKDIRSVRIEVEEGIYAGRVLYMDIRGQRAIPLTRTDENLTPGEIEKKAAELAYFLRVP IEVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1a (C1A/711), CF568 conjugate, 0.1mg/mL
BNC680711-500 1x 500 µL

CD1a (C1A/711), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (TRP/816), CF640R conjugate, 0.1mg/mL
BNC400816-500 1x 500 µL

P53 (TRP/816), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KIAA1310 (KANSL3) (NM_001115016) Human Recombinant Protein
TP326231 20 µg

KIAA1310 (KANSL3) (NM_001115016) Human Recombinant Protein

Sign In for Pricing
View Details
Human DEFB112 activation kit by CRISPRa
GA116703 1 Kit

Human DEFB112 activation kit by CRISPRa

Sign In for Pricing
View Details
Human PARP15 activation kit by CRISPRa
GA116130 1 Kit

Human PARP15 activation kit by CRISPRa

Sign In for Pricing
View Details
DJ-1 Antibody
8C0172-AAT 50 µg

DJ-1 Antibody

Sign In for Pricing
View Details