Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis UPF0316 protein yebE (yebE)

This Recombinant Bacillus subtilis UPF0316 protein yebE (yebE) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

UPF0316 protein yebE

UniProt

O34624

Expression Region

1-184

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMQTILSNGIAMVLIILIINIVYVSFFTIRMILTLKGQRYLAAGISTIEILVYVTGLSLV LDNLDQIQNVIAYALGYGLGVIVGMKIEEKLALGYIMVNVITKELDLDLPKQLREKGYGV TNWVAGGLEGDRTALQILTPRRYELQLYDTIKTLDSKAFIIAYEPKTIHGGFWVKAVKKR RIKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS704966 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
FT1A (FUT6) (NM_001040701) Human Over-expression Lysate
LY420745 100 µg

FT1A (FUT6) (NM_001040701) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS707794 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
Human HTRA3 activation kit by CRISPRa
GA114318 1 Kit

Human HTRA3 activation kit by CRISPRa

Sign In for Pricing
View Details
BAP1 (BRCA1 Associated Protein 1) (BAP1/2667), CF568 conjugate, 0.1mg/mL
BNC682667-100 1x 100 µL

BAP1 (BRCA1 Associated Protein 1) (BAP1/2667), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse IL-35 (Interleukin 35) ELISA Kit
E-EL-M0733-01 24 Tests

Mouse IL-35 (Interleukin 35) ELISA Kit

Sign In for Pricing
View Details