Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proteoglycan 4 (PRG4), partial

Product Specifications

Product Name Alternative

Lubricin (Megakaryocyte-stimulating factor) (Superficial zone proteoglycan) (MSF) (SZP)

Abbreviation

Recombinant Human PRG4 protein, partial

Gene Name

PRG4

UniProt

Q92954

Expression Region

25-156aa

Organism

Homo sapiens (Human)

Target Sequence

QDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKRVCTAELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAPPPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITE

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Signal Transduction

Relevance

Plays a role in boundary lubrication within articulating joints. Prevents protein deposition onto cartilage from synovial fluid by controlling adhesion-dependent synovial growth and inhibiting the adhesion of synovial cells to the cartilage surface.Isoform F plays a role as a growth factor acting on the primitive cells of both hematopoietic and endothelial cell lineages.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.6 kDa

References & Citations

"Purification, biochemical characterization, and cloning of a novel megakaryocyte stimulating factor that has megakaryocyte colony stimulating activity." Turner K.J., Fitz L.J., Temple P., Jacobs K., Larson D., Leary A.C., Kelleher K., Giannotti J., Calvetti J., Fitzgerald M., Kriz M.-J., Ferenz C., Grobholz J., Fraser H., Bean K., Norton C.R., Gesner T., Bhatia S. Clark S.C. Blood 78:279A-279A (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD21 Antibody
MBS9216704-01 0.1 mL

RAD21 Antibody

Sign In for Pricing
View Details
RAD21 Antibody
MBS9216704-02 5x 0.1 mL

RAD21 Antibody

Sign In for Pricing
View Details
F2RL2 Rabbit Polyclonal Antibody (FITC)
orb2097846 100 µL

F2RL2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
RHBDD2 Rabbit Polyclonal Antibody (BF594)
orb2464842 100 µL

RHBDD2 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Ruxolitinib Impurity 71
RM-R241271-01 10 mg

Ruxolitinib Impurity 71

Sign In for Pricing
View Details
Ruxolitinib Impurity 71
RM-R241271-02 25 mg

Ruxolitinib Impurity 71

Sign In for Pricing
View Details