Recombinant Human Proteoglycan 4 (PRG4), partial
Product Specifications
Product Name Alternative
Lubricin (Megakaryocyte-stimulating factor) (Superficial zone proteoglycan) (MSF) (SZP)
Abbreviation
Recombinant Human PRG4 protein, partial
Gene Name
PRG4
UniProt
Q92954
Expression Region
25-156aa
Organism
Homo sapiens (Human)
Target Sequence
QDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKRVCTAELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAPPPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITE
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Type
In Stock Protein
Source
Baculovirus
Field of Research
Signal Transduction
Relevance
Plays a role in boundary lubrication within articulating joints. Prevents protein deposition onto cartilage from synovial fluid by controlling adhesion-dependent synovial growth and inhibiting the adhesion of synovial cells to the cartilage surface.Isoform F plays a role as a growth factor acting on the primitive cells of both hematopoietic and endothelial cell lineages.
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
18.6 kDa
References & Citations
"Purification, biochemical characterization, and cloning of a novel megakaryocyte stimulating factor that has megakaryocyte colony stimulating activity." Turner K.J., Fitz L.J., Temple P., Jacobs K., Larson D., Leary A.C., Kelleher K., Giannotti J., Calvetti J., Fitzgerald M., Kriz M.-J., Ferenz C., Grobholz J., Fraser H., Bean K., Norton C.R., Gesner T., Bhatia S. Clark S.C. Blood 78:279A-279A (1991)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Partial
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC222479L3V 200 µL
PRR25 (NM_001013638) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
041114-FITC 200 µL
RNF14, CT (RNF14, ARA54, E3 ubiquitin-protein ligase RNF14, Androgen receptor-associated protein 54, HFB30, RING finger protein 14, Triad2 protein) (FITC) discontinued
Sign In for Pricing
View Details