Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Protein rer1 (rer1)

This Recombinant Schizosaccharomyces pombe Protein rer1 (rer1) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

Protein rer1, Retention of ER proteins 1

UniProt

Q10358

Expression Region

1-184

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFIQRHIENVKEKKNFAVRLYRHWVDRTIPYTTYRWLTVSGLIALFFIRILLVRGWYIV CYTLAIYLLNLFLAFLTPKFDPSVEQAMKDEEIEEGVLPTSKDDEFRPFIRRLPEFKFWY SSMRATLFALVASFFRIFDVPVFWPILVVYYLVLSFFCFRRQIQHMLKYRYVPFDIGKKK FGSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIP30 (HTATIP2) (NM_001098522) Human Over-expression Lysate
LY420620 100 µg

TIP30 (HTATIP2) (NM_001098522) Human Over-expression Lysate

Sign In for Pricing
View Details
Swap70 Mouse Gene Knockout Kit (CRISPR)
KN517028 1 Kit

Swap70 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tlr2 Mouse Gene Knockout Kit (CRISPR)
KN317625 1 Kit

Tlr2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAB7B (NM_001164522) Human Recombinant Protein
TP328755 20 µg

RAB7B (NM_001164522) Human Recombinant Protein

Sign In for Pricing
View Details
Abcg1 Mouse Gene Knockout Kit (CRISPR)
KN500639 1 Kit

Abcg1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Basic Water Purification System BBPS-105
BBPS-105 1 Unit

Basic Water Purification System BBPS-105

Sign In for Pricing
View Details