Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Protein rer1 (rer1)

This Recombinant Schizosaccharomyces pombe Protein rer1 (rer1) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

Protein rer1, Retention of ER proteins 1

UniProt

Q10358

Expression Region

1-184

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFIQRHIENVKEKKNFAVRLYRHWVDRTIPYTTYRWLTVSGLIALFFIRILLVRGWYIV CYTLAIYLLNLFLAFLTPKFDPSVEQAMKDEEIEEGVLPTSKDDEFRPFIRRLPEFKFWY SSMRATLFALVASFFRIFDVPVFWPILVVYYLVLSFFCFRRQIQHMLKYRYVPFDIGKKK FGSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CysLT2 (CYSLTR2) activation kit by CRISPRa
GA111374 1 Kit

Human CysLT2 (CYSLTR2) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Uterus
CS804959 5x 5 µm

Tissue FFPE Sections, Uterus

Sign In for Pricing
View Details
Reversan
TRC-R279800-5MG 5 mg

Reversan

Sign In for Pricing
View Details
ANK2 Antibody
KC-330-01 50 μL

ANK2 Antibody

Sign In for Pricing
View Details
ANK2 Antibody
KC-330-02 100 µL

ANK2 Antibody

Sign In for Pricing
View Details
ANK2 Antibody
KC-330-03 1 mL

ANK2 Antibody

Sign In for Pricing
View Details