Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum lycopersicum ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Solanum lycopersicum ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q2MIB4

Expression Region

1-184

Origin

Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNVTDSFVSLGHWPSAGSFGFNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LNTIRNSEELRGGAIEQLEKARSRLRKVETEAEQFRVNGYSEIEREKLNLINSTYKTLEQ LENYKNETIQFEQQRAINQVRQRVFQQALRGALGTLNSCLNNELHLRTISANIGMLGTMK EITD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified anti-mouse CD140a
E16FMU140a-100U 100 µg

Purified anti-mouse CD140a

Sign In for Pricing
View Details
PAKα Polyclonal Antibody
orb1412606 100 µL

PAKα Polyclonal Antibody

Sign In for Pricing
View Details
CARD11 Polyclonal Antibody
MBS9127733-01 0.02 mL

CARD11 Polyclonal Antibody

Sign In for Pricing
View Details
CARD11 Polyclonal Antibody
MBS9127733-02 0.1 mL

CARD11 Polyclonal Antibody

Sign In for Pricing
View Details
CARD11 Polyclonal Antibody
MBS9127733-03 5x 0.1 mL

CARD11 Polyclonal Antibody

Sign In for Pricing
View Details
HMGB1 Antibody [HMG314]
33-051 100 µg

HMGB1 Antibody [HMG314]

Sign In for Pricing
View Details