Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum lycopersicum ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Solanum lycopersicum ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q2MIB4

Expression Region

1-184

Origin

Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNVTDSFVSLGHWPSAGSFGFNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LNTIRNSEELRGGAIEQLEKARSRLRKVETEAEQFRVNGYSEIEREKLNLINSTYKTLEQ LENYKNETIQFEQQRAINQVRQRVFQQALRGALGTLNSCLNNELHLRTISANIGMLGTMK EITD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human C-C Motif Chemokine 23/CCL23
C090-10ug 10 µg

Recombinant Human C-C Motif Chemokine 23/CCL23

Sign In for Pricing
View Details
Lentiviral mouse Zfp229 shRNA (UAS) - Lentiviral mouse Zfp229 shRNA (UAS) (25)
GTR15243029 1 Vial

Lentiviral mouse Zfp229 shRNA (UAS) - Lentiviral mouse Zfp229 shRNA (UAS) (25)

Sign In for Pricing
View Details
Chlorflurenol
444336-01 100 mg

Chlorflurenol

Sign In for Pricing
View Details
Chlorflurenol
444336-02 250 mg

Chlorflurenol

Sign In for Pricing
View Details
LOC691601 3'UTR GFP Stable Cell Line
TU262370 1.0 mL

LOC691601 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Atat1 (NM_001142745) Mouse Tagged Lenti ORF Clone
MR222771L3 10 µg

Atat1 (NM_001142745) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details