Recombinant Aspergillus oryzae Mitochondrial import inner membrane translocase subunit tim22 (tim22)
This Recombinant Aspergillus oryzae Mitochondrial import inner membrane translocase subunit tim22 (tim22) spans the amino acid sequence from region 1-184.
Product Specifications
Product Name Alternative
Mitochondrial import inner membrane translocase subunit tim22
UniProt
Q2UAP8
Expression Region
1-184
Origin
Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNIPGMTTGMAPAGATAGAGFPGAGAGMQGMSEQEQAMVKAMHAAMESCPVKTVISGTMG FGLGGVFGLFMASMSYDSTFTPQGKAIMDLPWREQVRRGFKDMGSRSWSSAKNFGIVGAL YSGTECCVEGLRAKNDLSNSVISGCITGGILGAKAGPQAAAAGCAGFAAFSAAIDAYMRM PSEE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6409746-01 0.1 mL
CBR4 (Carbonyl Reductase [NADPH] 4, SDR45C1) (FITC)
Sign In for Pricing
View Details MBS6409746-02 5x 0.1 mL
CBR4 (Carbonyl Reductase [NADPH] 4, SDR45C1) (FITC)
Sign In for Pricing
View Details MBS6144917-01 0.1 mL
TRIM13 (LEU5, RFP2, RNF77, E3 Ubiquitin-protein Ligase TRIM13, B Cell Chronic Lymphocytic Leukemia Tumor Suppressor Leu5, Leukemia-associated Protein 5, Putative Tumor Suppressor RFP2, RING Finger Protein 77, Ret Finger Protein 2, Tripartite Motif-contain
Sign In for Pricing
View Details