Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactuca sativa ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Lactuca sativa ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q56P07

Expression Region

1-184

Origin

Lactuca sativa (Garden lettuce)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNVTDSFVSLGHWPSAGSFGFNTDILATNLINLSVVLGVLIFFGKGVLSDLLDNRKQRI LNTIRNSEELREGAIEQLEKARARLRKVEIEADQFRVNGYSEIEREKLNLIDSTYKTLEQ LENYKNETINFEQQKASNQVRQRVFQQALQGALGTLNSCLNSELHLRTISANIGILGAMK EITD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Troponin I Type 2, Fast Skeletal (TNNI2) ELISA Kit
RDR-TNNI2-Ra-01 96 Tests

Rat Troponin I Type 2, Fast Skeletal (TNNI2) ELISA Kit

Sign In for Pricing
View Details
Rat Troponin I Type 2, Fast Skeletal (TNNI2) ELISA Kit
RDR-TNNI2-Ra-02 48 Tests

Rat Troponin I Type 2, Fast Skeletal (TNNI2) ELISA Kit

Sign In for Pricing
View Details
c-Jun (JUN) pSer73 Rabbit Polyclonal Antibody
AP02305PU-N 100 µL

c-Jun (JUN) pSer73 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CD40/TNFRSF5 Protein (mFc Tag)
PKSH033724-01 10 µg

Recombinant Human CD40/TNFRSF5 Protein (mFc Tag)

Sign In for Pricing
View Details
Recombinant Human CD40/TNFRSF5 Protein (mFc Tag)
PKSH033724-02 50 µg

Recombinant Human CD40/TNFRSF5 Protein (mFc Tag)

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR562007 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details