Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Mitochondrial import inner membrane translocase subunit Tim22 (timm22)

This Recombinant Xenopus laevis Mitochondrial import inner membrane translocase subunit Tim22 (timm22) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit Tim22

UniProt

Q5U4U5

Expression Region

1-184

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSNVTPPGDGTLQYSLIMQHLVGDKRRPVELIPGGLGGIPTPIKPEEQKMMERVMESCG FKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPLRTPTAKEVLRDMGQRGMSYAKNFA IVGAMFSCTECLVESYRGKSDWKNSVMSGCITGGAIGFRAGLKAGVLGCGGFAAFSAVID YYLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 19 (KRT19/800), Biotin conjugate, 0.1mg/mL
BNCB0800-100 1x 100 µL

Cytokeratin 19 (KRT19/800), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS703598 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
3-Aminosalicylic Acid
TRC-A629260-500MG 500 mg

3-Aminosalicylic Acid

Sign In for Pricing
View Details
Acyltransferase like 1 (LPCAT2) (NM_017839) Human Over-expression Lysate
LC402622 20 µg

Acyltransferase like 1 (LPCAT2) (NM_017839) Human Over-expression Lysate

Sign In for Pricing
View Details
Pasireotide TFA Salt
TRC-P211010-5MG 5 mg

Pasireotide TFA Salt

Sign In for Pricing
View Details
Neurofibromin (NF1) Human Gene Knockout Kit (CRISPR)
KN220378 1 Kit

Neurofibromin (NF1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details