Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Physcomitrella patens subsp. patens Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Physcomitrella patens subsp. patens Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q6YXR4

Expression Region

1-184

Origin

Physcomitrella patens subsp. patens (Moss)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRESDWLWVEPIMGSRRVSNFCWAAILLFGALGFFFVGISSYFGKDLIPFLSSQQILFV PQGVVMCFYGIAGLFLSFYLWCTIFWNVGSGYNKFDKKKKIVSLFRWGFPGENRRICINF FMKDIQGIRMEVQEGIYPRRTLYMKIKGQQDIPLTRIRENLTLGEIEEKAAELARFLRVS IEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-100 1x 100 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF594 conjugate, 0.1mg/mL
BNC940164-100 1x 100 µL

CD28 (204.12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL
BNC880437-500 1x 500 µL

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (KRT10/1990R), CF640R conjugate, 0.1mg/mL
BNC401990-500 1x 500 µL

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (KRT10/1990R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF740 conjugate, 0.1mg/mL
BNC742651-100 1x 100 µL

Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1952), CF594 conjugate, 0.1mg/mL
BNC941952-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1952), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details