Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b, chloroplastic (atpF)

This Recombinant ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q70XU9

Expression Region

1-184

Origin

Amborella trichopoda

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNVTDSFVSLGHWPSAGSFGFNTDIFATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LSTIRNSEELRGGAIEQLEKARARLRKVEIEADEFRVNGYSEIEREKSNLINAAYENLER LENYKNESIHFEQQRAMNQVRQRVFQQALQGALETLNSYLNSELHLRTISANIGMLGTMK NITD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc6a14 Mouse Gene Knockout Kit (CRISPR)
KN516171 1 Kit

Slc6a14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant MBL2 Monoclonal Antibody
AN301978L-01 50 µL

Recombinant MBL2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant MBL2 Monoclonal Antibody
AN301978L-02 100 µL

Recombinant MBL2 Monoclonal Antibody

Sign In for Pricing
View Details
HSF1 (Ab-121) Antibody
8B8041-AAT 50 µg

HSF1 (Ab-121) Antibody

Sign In for Pricing
View Details
Vinyl Butyrate
TRC-V424200-5MG 5 mg

Vinyl Butyrate

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), 0.2mg/mL
BNUB2095-500 1x 500 µL

HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), 0.2mg/mL

Sign In for Pricing
View Details