Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b, chloroplastic (atpF)

This Recombinant ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q70XU9

Expression Region

1-184

Origin

Amborella trichopoda

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNVTDSFVSLGHWPSAGSFGFNTDIFATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LSTIRNSEELRGGAIEQLEKARARLRKVEIEADEFRVNGYSEIEREKSNLINAAYENLER LENYKNESIHFEQQRAMNQVRQRVFQQALQGALETLNSYLNSELHLRTISANIGMLGTMK NITD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene AM CHO
H12516006.25G 25 g

Polystyrene AM CHO

Sign In for Pricing
View Details
GGN Human qPCR Primer Pair (NM_152657)
HP217875 200 Reactions

GGN Human qPCR Primer Pair (NM_152657)

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF640R conjugate, 0.1mg/mL
BNC402284-500 1x 500 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
dcr-1 (Center) Rabbit Polyclonal Antibody
AP11794PU-N 400 µL

dcr-1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS513377 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Recombinant IKK alpha Antibody
RC-5331-01 50 μL

Recombinant IKK alpha Antibody

Sign In for Pricing
View Details