Recombinant Mycoplasma mobile ATP synthase subunit b (atpF)
This Recombinant Mycoplasma mobile ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-184.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
Q6KI77
Expression Region
1-184
Origin
Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Field of Research
Infectious Disease & Virology; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLELGIFSSNTQNIGQSISERFAGIFPSWPIMLATLVSFTILLVVLTKLIYKPVKKMMKN RRDFIQNNIDESTKQVEKSNELLEKSNIEILDAKIKANTIIKDAQILAEEIKNNSIKDAK DKSKQLLEETKIYIRQQKVLFAKESKKEIVEIAGEMTKKILSESDVKLEDSKFLENLLKN DITK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRV-0025205 96 Tests
Multiplex Assay Kit for Inhibin Beta E (INHbE), etc. by FLIA (Flow Luminescence Immunoassay)
Sign In for Pricing
View Details 
orb3082694 100 µg
Cyclin-dependent kinase 2 Cdk2 Rabbit Polyclonal Antibody (Fluoro488)
Sign In for Pricing
View Details