Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Atropa belladonna ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Atropa belladonna ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q8S8Y2

Expression Region

1-184

Origin

Atropa belladonna (Belladonna) (Deadly nightshade)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNVTDSFVSLGHWPSAGSFGFNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LNTIRNSEELREGAIEQLEKARSRLRKVETEAEQFRVNGYSEIEREKLNLINSTYKTLEQ LENYKNETIQFEQQRAINQVRQRVFQQALRGALGTLNSCLNNELHLRTISANIGMLGTMK EITD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUZ12 (NM_015355) Human Recombinant Protein
TP302362M 100 µg

SUZ12 (NM_015355) Human Recombinant Protein

Sign In for Pricing
View Details
CD44 antibody (biotin)
61R-CD44gMSBT 500 ug

CD44 antibody (biotin)

Sign In for Pricing
View Details
ATP6V0A1 Protein Vector (Human) (pPB-N-His)
PV003150 500 ng

ATP6V0A1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
TLR2 Antibody (Center)
orb31781-01 50 µL

TLR2 Antibody (Center)

Sign In for Pricing
View Details
TLR2 Antibody (Center)
orb31781-02 100 µL

TLR2 Antibody (Center)

Sign In for Pricing
View Details
LENG4 Rabbit Polyclonal Antibody (Cy5)
orb953408 100 µL

LENG4 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details