Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psilotum nudum Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Psilotum nudum Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q8WI09

Expression Region

1-184

Origin

Psilotum nudum (Whisk fern) (Lycopodium nudum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRQSEWIRVESIRGARRISNFFWAFILILGALGFLLVGSSSYLGRDLIPLLPSQQIVFI PQGIVMCFYGIAGISIGFYLGFAISWDIGNGYNLFDKQRGIVRIFRWGFPGENRRICIQF FMKDIQAIGLEIREGFYSRRIIYMRMKGQQKIFLTHISENSTLKEMEEKAANLARFMCVS IEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS705339 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
RALYL (NM_001100392) Human Over-expression Lysate
LY420244 100 µg

RALYL (NM_001100392) Human Over-expression Lysate

Sign In for Pricing
View Details
AGPAT2 Human Gene Knockout Kit (CRISPR)
KN400228 1 Kit

AGPAT2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Heneicosane
TRC-H245500-5G 5 g

Heneicosane

Sign In for Pricing
View Details
MRPL42 Human Gene Knockout Kit (CRISPR)
KN401482 1 Kit

MRPL42 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MHC class I Monoclonal Antibody (W6/32)
E-AB-48031-01 25 µL

MHC class I Monoclonal Antibody (W6/32)

Sign In for Pricing
View Details