Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psilotum nudum ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Psilotum nudum ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q8WI29

Expression Region

1-184

Origin

Psilotum nudum (Whisk fern) (Lycopodium nudum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINAINLPISLNNGPPAGGFGLNTNIFEINIINLGIVIGLLVYLGEGVLTNLLVNRKQTI LSTIRDAEERYREATDKLKQARARLQQAKVKAGEIRSNGLARMEREKQDLINAADEDSKR LEESKNSTIRFEEQRAIEQVRQQVSRLALERVLESLKSRFNSELHSRMIDYHIDLIKSME GTTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Padi2 Mouse Gene Knockout Kit (CRISPR)
KN312746LP 1 Kit

Padi2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Factor XIIIa Monoclonal Antibody
AN301519L-01 50 µL

Recombinant Factor XIIIa Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Factor XIIIa Monoclonal Antibody
AN301519L-02 100 µL

Recombinant Factor XIIIa Monoclonal Antibody

Sign In for Pricing
View Details
Human SETDB2 activation kit by CRISPRa
GA113273 1 Kit

Human SETDB2 activation kit by CRISPRa

Sign In for Pricing
View Details
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3179), Biotin conjugate, 0.1mg/mL
BNCB3179-500 1x 500 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3179), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C2orf18 (SLC35F6) Rabbit Polyclonal Antibody
TA366526 100 µL

C2orf18 (SLC35F6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details