Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psilotum nudum ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Psilotum nudum ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q8WI29

Expression Region

1-184

Origin

Psilotum nudum (Whisk fern) (Lycopodium nudum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINAINLPISLNNGPPAGGFGLNTNIFEINIINLGIVIGLLVYLGEGVLTNLLVNRKQTI LSTIRDAEERYREATDKLKQARARLQQAKVKAGEIRSNGLARMEREKQDLINAADEDSKR LEESKNSTIRFEEQRAIEQVRQQVSRLALERVLESLKSRFNSELHSRMIDYHIDLIKSME GTTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRS2 (NM_001042555) Human Over-expression Lysate
LC420983 20 µg

FRS2 (NM_001042555) Human Over-expression Lysate

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/282), CF640R conjugate, 0.1mg/mL
BNC400282-500 1x 500 µL

HER-2 / CD340 (HRB2/282), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Propamocarb
TRC-P758460-1G 1 g

Propamocarb

Sign In for Pricing
View Details
LAP2 (TMPO) (NM_001032283) Human Recombinant Protein
TP720158M 50 µg

LAP2 (TMPO) (NM_001032283) Human Recombinant Protein

Sign In for Pricing
View Details
EXOSC10 Antibody
KC-994-01 50 μL

EXOSC10 Antibody

Sign In for Pricing
View Details
EXOSC10 Antibody
KC-994-02 100 µL

EXOSC10 Antibody

Sign In for Pricing
View Details