Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b, chloroplastic (atpF)

This Recombinant ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q9BBS4

Expression Region

1-184

Origin

Lotus japonicus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNITDPFPCLGYWPSAGSFGFNTDILATNPINLSIVIGVLIFFGKGVLSDLLDNRKQRI LRTIRNSEELREGAIEQLEKAQARLKKVETEADRFRVNGYSEIEREKLNLINSIYTTLEQ LENYKNETIHFEQQRAINQVRQRVLQQALQGALGTLNSCLNNELHFRTIAANIGMFGAMK EKNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lfng Antibody
orb860379 2 mg

Lfng Antibody

Sign In for Pricing
View Details
Z804A Rabbit Polyclonal Antibody
JOT-AP13603-01 20 µL

Z804A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Z804A Rabbit Polyclonal Antibody
JOT-AP13603-02 50 μL

Z804A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Z804A Rabbit Polyclonal Antibody
JOT-AP13603-03 100 µL

Z804A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RFESD Protein Vector (Mouse) (pPM-C-HA)
PV223628 500 ng

RFESD Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Ptk2b Blocking Peptide (P851)
MBS9230218-01 0.5 mg

Mouse Ptk2b Blocking Peptide (P851)

Sign In for Pricing
View Details