Recombinant Pinus thunbergii Photosystem I assembly protein Ycf4 (ycf4)
This Recombinant Pinus thunbergii Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-184.
Product Specifications
Product Name Alternative
Photosystem I assembly protein Ycf4
UniProt
P41620
Expression Region
1-184
Origin
Pinus thunbergii (Japanese black pine) (Pinus thunbergiana)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNRRSKWLWIEPITGSRKRSNFFWACILFLGSLGFFLVGISSYFGENLIPLLSSQQILFV PQGIVMCFYGIAGLFISSYLWCTILFNVGSGYNKFDKKKGIVCLFRWGFPGINRRIFPRF LMKDIQMIKMEIQEGISPRRVLYMEIKGRQDIPLTRTGDNVNLREIEQKAAESARFLRVS IEGF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740460-100 1x 100 µL
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681628-500 1x 500 µL
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681203-100 1x 100 µL
Smooth Muscle Actin (ACTA2/791 +1A4), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401648-100 1x 100 µL
TIMP1 (Marker of Lymph Node Metastasis) (2A5), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details